It is involved in the interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion. This antibody reacts with human. Desmocollin-1 Antibodies available through Novus Biologicals. Rabbit polyclonal antibody to Desmocollin 1 + 2. 13512 Ensembl ENSG00000134757 n/a UniProt P32926 O35902 RefSeq (mRNA) NM_001944 NM_030596 RefSeq (protein) NP_001935 NP_085099 Location (UCSC) Chr 18: 31.45 – 31.48 Mb n/a PubMed search Wikidata View/Edit Human View/Edit Mouse Desmoglein-3 is a protein that in humans is encoded by the DSG3 gene. View our protocol for Staining Membrane­ associated Proteins. Cat.No. Desmocollin-1 and -2, by contrast, are preferentially localized in … Anti-Desmocollin 3 antibodies are available from several suppliers. IHC testing of FFPE human skin with Desmocollin 2/3 antibody (clone 7G6). Anti-Desmocollin-2 Antibody, clone 7G6. Applications Key Ab Array Antibody array AbSeq AbSeq AE Affinity electrophoresis 13876-1-AP. 100 μg. Rabbit Polyclonal Anti-Desmocollin-1 Antibody. Immunohistochemistry-Paraffin: Desmocollin-1 Antibody [NBP1-88099] - Staining of human fallopian tube shows very weak membranous positivity in glandular cells. The relative expression levels of Desmocollin 3 within each tissue is shown using RNA-Seq. This antibody reacts with human. It is involved in the interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion. J Histochem Cytochem 2010 Mar [PMID: 19901271]. Germany, Phone +49 (0)241 95 163 153 Request Lead Time; In stock and ready for quick dispatch; Usually dispatched within 5 … (NBP1-88099) Desmocollin-1 Antibody Antibody info; Additional info; Supplier Novus Biologicals. Mouse monoclonal Desmocollin 1 antibody Home. Mouse Monoclonal Desmocollin 1 antibody for IHC, WB. Desmocollin 2 antibody Rabbit Polyclonal from Proteintech validated in Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF), Enzyme-linked Immunosorbent Assay (ELISA) applications. 100 μg. Whole cell extracts (30 μg) was separated by 7.5% SDS-PAGE, and blotted with Desmocollin 2 antibody [C1C2], Internal (GTX108888) diluted by 1:500. Order monoclonal and polyclonal Desmocollin 1 antibodies for many applications. Desmocollin 1 antibody LS-C22805 is an unconjugated mouse monoclonal antibody to human Desmocollin 1 (DSC1) (Intracellular). MLS128 antibody-induced suppression of colon cancer cell growth is mediated by a desmocollin and a 110 kDa glycoprotein. There are no specific FAQs related to this product. View All Primary Antibodies ; Monoclonal Antibodies Desmocollin-1 antibody was used at 1:60 dilution on RT-4 and U-251MG lysate(s). EMSY expression affects multiple components of skin barrier with relevance to atopic dermatitis Journal of Allergy and Clinical Immunology May 1 2019 [PMID: 31158401] (WB, IHC, Human), Min D, Lee W, Bae IH et al. The Desmocollin-1 Antibody from Novus is a rabbit polyclonal antibody to Desmocollin-1. The anti-desmocollin 3 antibody localizes desmocollin 3 in living epidermal layers, glandular ducts cells, basal matrix cells, basal and suprabasal layers of stratified epithelia, and thymic reticulum cells. Desmocollin-3 is one of the principal components of desmosomes which form adhesive contacts between epithelial cells (1, 2). anti-Desmocollin 1 antibody is a Rabbit Polyclonal antibody recognizes Desmocollin 1, which can be used for Flow cytometry,IHC-Formalin-fixed paraffin-embedded sections,Western blot … The Desmocollin-1 Antibody from Novus is a rabbit polyclonal antibody to Desmocollin-1. We have 1 review tested in 1 species: Canine. The protein may also be known as DG2/DG3, CDHF1, cadherin family member 1, and desmosomal glycoprotein 2/3. Compare Anti-Desmocollin 1 (DSC1) Antibody Products from leading suppliers on Biocompare. The Desmocollin-1 Antibody has been validated for the following applications: Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin. Fax +49 (0)241 95 163 155, german (deutsch) There are no specific blogs for Desmocollin-1, but you can. PRODUCT AVAILABILITY: Update Regarding the Evolving COVID-19 Situation, Bio-Techne appreciates the critical role that you and our products and services play in research efforts to further scientific innovation and discovery. The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Availability. Validated for IHC and WB. Purified and conjugated research monoclonal antibodies, polyclonal antibodies, & custom antibody services for your research needs. anti-Desmocollin 1 antibody is a Rabbit Polyclonal antibody recognizes Desmocollin 1, which can be used for Flow cytometry,IHC-Formalin-fixed paraffin-embedded sections,Western blot … Desmocollin 1 antibody LS-C193351 is an unconjugated mouse monoclonal antibody to human Desmocollin 1 (DSC1). Add to Cart. Secondary All lanes : Goat Anti-Mouse IgG (H&L)-HRP Conjugate at 1/2500 dilution antikoerper-online.de, english (english) Immunogen corresponding to synthetic peptide. Validated for IHC and WB. Order anti-Desmocollin 1 antibody ABIN6868586. Mouse anti Desmoplakin 1/2 antibody, clone DP-2.15 can be used for the detection of primary and metastatic carcinomas. antibodies-online.com, french (français) Mouse monoclonal Desmocollin 1 antibody Home. Aliquot and store at -20C long term. Desmocollin 1 (DSC1) Antibody is a Rabbit Polyclonal antibody against Desmocollin 1 (DSC1). Request Lead Time; In stock and ready for quick dispatch; Usually dispatched within 5 to 10 working days. genomics-online.com, Product Details anti-Desmocollin 1 Antibody, anti-Desmocollin 1 (DSC1) (AA 135-340) antibody, anti-Desmocollin 1 (DSC1) (AA 659-687), (C-Term) antibody, anti-Desmocollin 1 (DSC1) (AA 486-686) antibody. Primary Antibodies . Desmocollin 1 antibody; Size Price Qty. ©2021 Novus Biologicals, All Rights Reserved. It is expressed in the basal and suprabasal layers of stratified epithelia in many tissues (5, 7, 8). Desmocollin 1 is a component of intercellular desmosome junctions. Industrial & Scientific Hello, Sign in. 200 μg. Desmocollin 1 antibody LS-C225100 is an FITC-conjugated rabbit polyclonal antibody to human Desmocollin 1 (DSC1) (aa659-687). Validated for ELISA and WB. Schloss-Rahe-Str. Desmocollin 1 (DSC1) Antibody is a Rabbit Polyclonal antibody against Desmocollin 1 (DSC1). This antibody reacts with human, mouse samples. Immunohistochemistry-Paraffin: Desmocollin-1 Antibody [NBP1-88099] - Staining of human prostate shows no membranous positivity in glandular cells. Read our general, Discover related pathways, diseases and genes to Desmocollin-1 Antibody (NBP1-88099). Anti-Desmocollin 3 Antibody Products. {RE} Selected quality suppliers for anti-Desmocollin 1 antibodies. The HRP-conjugated anti-rabbit IgG antibody (GTX213110-01) was used to detect the primary antibody. The Desmocollin-1 Antibody has been validated for the following applications: Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin. Desmocollin­1 was detected in perfusion fixed frozen sections of mouse skin using Rat Anti­ Human/Mouse Desmocollin­1 Monoclonal Antibody (Catalog # MAB7367) at 1.7 µg/mL overnight at 4 °C. This product is for research use only and is not approved for use in humans or in clinical diagnosis. Desmocollin-1 was detected in immersion fixed A549 human lung carcinoma cell line using Rat Anti-Human/Mouse Desmocollin-1 Monoclonal Antibody (Catalog # MAB7367) at 10 µg/mL for 3 hours at room temperature. Request Lead Time; In stock and ready for quick dispatch; Usually dispatched within 5 … Desmoglein Antibodies (1 and 3) - To detect the presence of auto antibody specific to Desmoglein 1 and/or 3 in a patients serum as an aid to diagnose type of pemphigus. We have publications tested in 1 confirmed species: Human. Desmocollin 1 antibody Biorbyt's Desmocollin 1 antibody is a Rabbit Polyclonal antibody. Tested Reactivity: Human. Rabbit Polyclonal Desmocollin 1 antibody for IF/ICC, IHC, IP, WB. View application images and datasheets for 86 anti Desmocollin-1 Antibody antibodies from 15 leading antibody suppliers, plus reviews and the top related antibodies antibodies-online GmbH Tissue was stained using the Anti­Rat HRP­DAB Cell & … Host Rabbit Type Primary Clonality Polyclonal Conjugate Unconjugated Target Desmocollin-1 UniProt Q08554 - DSC1_HUMAN. For best experience we recommend to activate Javascript in your browser. Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars. Desmocollin 1 is a component of intercellular desmosome junctions. This antibody has been shown to work in applications such as: EIA, Immunoassay, ELISA, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Immunohistochemistry - fixed, and … Test Resources. Test in a species/application not listed above to receive a full credit towards a future purchase. Skip to main content.us. View All Primary Antibodies ; Monoclonal Antibodies View specifications, prices, citations, reviews, and more. Desmocollin 1 DSC1 Polyclonal Antibody product information; Desmocollin 1 DSC1 Polyclonal Antibody is available 8 times from supplier bioma at Gentaur.com shop Miyazaki H, Tsunoi Y, Akagi T et al. Rabbit Polyclonal Desmocollin 1 antibody for ELISA, FACS, IHC, WB. Order anti-Desmocollin 1 antibody ABIN933547. Order anti-Desmocollin 1 anticorps ABIN6566762. Desmocollin 2 antibody [C1C2], Internal detects Desmocollin 2 protein by western blot analysis. $365.50. Desmosomes are cell-cell junctions that help resist shearing forces and are found in high concentrations in cells subject to mechanical stress. The anti-desmocollin 1 antibody localizes desmocollin 1 in suprabasal layers of interfollicular epidermis, specific cell layers, e.g. Diseases associated with DSC1 include Subcorneal Pustular Dermatosis and Iga Pemphigus.Among its related pathways are Keratinization and Innate Immune System.Gene Ontology (GO) annotations related to this gene include calcium ion binding.An important paralog of this gene is DSC2. This antibody recognizes Human antigen. Desmocollin‑1 in A549 Human Cell Line. Rabbit polyclonal Desmocollin 1 antibody. It may contribute to epidermal cell positioning (stratification) by mediating differential … Add to Cart. hair follicle root sheat, and Hassall bodies. Anti Desmocollin 1 DSC1 Antibody product information; Anti Desmocollin 1 DSC1 Antibody is available 8 times from supplier MBS Polyclonals at Gentaur.com shop The expected protein mass is 100 kDa, but there are 2 reported isoforms. Antibody: Rabbit Desmocollin-1 (DSC1) Polyclonal Antibody. SDS-PAGE analysis of purified, BSA-free Desmocollin 2/3 antibody (clone 7G6) as confirmation of integrity and purity. The DSC1 / Desmocollin 1 Antibody has been validated for the following applications: Flow Cytometry, Immunohistochemistry, Immunohistochemistry - fixed, and … Validated: IHC, IHC-P. Desmocollin‑1 in A549 Human Cell Line. It has been found that Desmoglein-1 is the target antigen in majority of the cases linked to IgG/IgA pemphigus, which is an autoimmune IgG/IgA antibody mediated response. $595.00. Simple Western: Desmocollin-1 Antibody [NBP1-88099] - Simple Western lane view shows a specific band for Desmocollin-1 in 0.5 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. In humans, this protein is encoded by the gene DSC1. Exp. Need help? Immunohistochemistry-Paraffin: Desmocollin-1 Antibody [NBP1-88099] - Staining of human skin shows moderate to strong membranous positivity in epidermal cells. Desmocollin‑1 was detected in immersion fixed A549 human lung carcinoma cell line using Rat Anti-Human/MouseDesmocollin‑1 Monoclonal Antibody (Catalog # MAB7367) at 10 µg/mL for 3 hours at room temperature. It may contribute to epidermal … Store at 4C short term. Gene DSC1 Modification Unmodified Order anti-Desmocollin 1 anticorps ABIN933547. Bioprinting of Biomimetic Skin containing Melanocytes. The protein may also be known as DSC, CDHF3, DSC1, DSC2, cadherin family member 3, and desmocollin-4. Mouse anti Desmoplakin 1/2 antibody, clone DP-2.15 recognizes both desmoplakin 1 and 2 from stratified epithelia, simple epithelia including glands, urothelium, thymic reticular epithelium, hepatocytes, intercalated disks of myocardium and arachnoid cells of meninges. Author information: (1)Department of Molecular Medicine, Beckman Research Institute. Rabbit Polyclonal Anti-DSC1 Antibody. Primary Antibodies are. Desmocollin 1 antibody LS-C22805 is an unconjugated mouse monoclonal antibody to human Desmocollin 1 (DSC1) (Intracellular). Currently, and as we abide by local shelter in place orders across the world, we are fully operational and do not anticipate any material supply disruptions across our Bio-Techne brands and product lines. Desmocollin 1 DSC1 Polyclonal Antibody product information; Desmocollin 1 DSC1 Polyclonal Antibody is available 8 times from supplier bioma at Gentaur.com shop Anti-Desmocollin 1 antibodies are available from several suppliers. Souris Desmocollin 1 Monoclonal anticorps pour IHC, WB. Select your country/region View All Primary Antibodies ; Monoclonal Antibodies WHERE SCIENCE INTERSECTS INNOVATIONTM. Desmocollin 1 antibody; Size Price Qty. In humans, this protein is encoded by the gene DSC3. Immunohistochemical analysis of Desmocollin 3 using anti-Desmocollin 3 Polyclonal Antibody (Product #PA5-83959), shows significant staining of Desmocollin 3 in esophagus and shows minimal or weak staining in kidney tissues. Click here for more. 52072 Aachen Simple Western: Desmocollin-1 Antibody [NBP1-88099] - Electropherogram image(s) of corresponding Simple Western lane view. Availability. Validated in IHC and tested in Human. View specifications, prices, citations, reviews, and more. Validated for IHC and WB. Order anti-Desmocollin 1 antibody ABIN6139825. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest. Desmocollins, along with desmogleins, are cadherin-like transmembrane glycoproteins that are major components of the desmosome. Sales & Advice: UK +44 (0) 1223 755950 / US +1 832 327 7413 / £ Pound Sterling Desmocollin-1: Products. Gene DSC1 Modification Unmodified View all Protocols, Troubleshooting, Illustrated assays and Webinars. Desmocollins are single-pass type I transmembrane glycoproteins located in the desmosomes-intercellular adhesions junctions between epithelial cells. $365.50. (NBP2-62695) Desmocollin-1 Antibody Antibody info; Additional info; Supplier Novus Biologicals. 1 Product Result | Match Criteria: Description Product # Clonality Application Species Reactivity Citations MABT411; 7G6, … In the skin epidermis Desmoglein-3 is expressed in the basal lower … This antibody was developed against Recombinant Protein corresponding to amino acids: SCTGTLVVHLDDYNDHAPQIDKEVTICQNNEDFAVLKPVDPDGPENGPPFQFFLDNSASKNWNIEEKDGKTAILRQRQNLDYNYYSVPIQIKDRHGLVATHMLTVRVCDCSTPSECRMKDKSTR. Required HIER: boil tissue sections in 10mM Tris with 1mM EDTA, pH 9, for 10-20 min. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Rabbit Polyclonal Desmocollin 1 antibody for WB. Antibody [orb318114] Desmocollin 1 antibody (FITC) by Biorbyt. Mouse monoclonal Desmocollin 1 antibody Home. Dermatol. $595.00. Order anti-Desmocollin 1 antibody ABIN5576843. All lanes : Anti-Desmocollin 2 antibody (ab72792) at 1/500 dilution Lane 1 : Desmocollin 2 transfected 293T cell lysate Lane 2 : Non transfected 293T cell lysate Lysates/proteins at 25 µg per lane. Compare Anti-Desmocollin 1 (DSC1) Antibody Products from leading suppliers on Biocompare. Desmocollin-1 was detected in immersion fixed A549 human lung carcinoma cell line using Rat Anti-Human/Mouse Desmocollin-1 Monoclonal Antibody (Catalog # MAB7367) at 10 µg/mL for 3 hours at room temperature. anticorps-enligne.fr, chinese (中文) 200 μg. Lapin Desmocollin 1 Polyclonal anticorps pour WB. Desmocollins belong to the the cadherin family of calcium-dependent adhesion molecules and may mediate differential adhesiveness between cells that express different isoforms. This experiment was performed under reducing. Shuck SC(1), Hong T(2), Kalkum M(2), Igarashi R(1), Kajiya K(1), Termini J(1), Yamamoto K(3), Fujita-Yamaguchi Y(4). Sales & Advice: UK +44 (0) 1223 755950 / US +1 832 327 7413 / £ Pound Sterling Application: Validated by immunofluorescence labeling (1:100) Reactivity: Human, mouse, rat. Discover more about diseases related to Desmocollin-1 Antibody (NBP1-88099). This gene encodes a member of the desmocollin protein subfamily. Read the. View all of our anti-Rabbit Secondary Antibodies, Goat anti-Rabbit IgG Secondary Antibody [HRP (Horseradish Peroxidase)], Paraffin sections of canine folicular skin (dogs with pemphigus foliaceus), Immunohistochemistry-Paraffin 1:200 - 1:500. We are continually assessing our manufacturing and supplier capabilities during the COVID-19 situation and are implementing precautionary measures to ensure uninterrupted supply of products and services. The impact of tissue fixatives on morphology and antibody-based protein profiling in tissues and cells. Note: Mouseover a species abbreviation on the product page to display the fullname. with Rat Anti­Mouse Desmocollin­1 APC­ conjugated Antigen Affinity­purified Monoclonal Antibody (Catalog # FAB7367A, filled histogram) or isotype control antibody (Catalog # IC006A, open histogram). Availability. Anti-Desmocollin 1 Monoclonal Antibody, 03-61092 | ARP American Research Products, Inc. Simple Western: Desmocollin-1 Antibody [NBP1-88099] - Simple Western lane view shows a specific band for Desmocollin-1 in 0.5 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. 35(3$5$7,21$1'6725$* Primary Antibodies . Mouse Monoclonal Desmocollin 1 antibody for IHC, WB. DSC1 (Desmocollin 1) is a Protein Coding gene. Avoid freeze-thaw cycles. Order anti-Desmocollin 1 antibody ABIN6030406. Concentration: 0.25 mg/ml purified IgG. Browse our Desmocollin-1 Antibody catalog backed by our Guarantee+. Learn more about PTMs related to Desmocollin-1 Antibody (NBP1-88099). Desmoglein-1 is also a target of Staphylococcus Exotoxins A and B which contribute to the pathoaetiology of Staph Scalded Skin Syndrome (SSSS). Specificity of human Desmocollin-1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. Rabbit Polyclonal Desmocollin 1 antibody for IHC (p). Host Rabbit Type Primary Clonality Polyclonal Conjugate Unconjugated Target Desmocollin-1 UniProt Q08554 - DSC1_HUMAN. As the situation evolves, our goal is to utilize preventive measures to reduce the threat that COVID-19 poses to our ability to meet the needs of our customers globally. 100% Guaranteed. Apr 28 2017 [PMID: 28453913] (Human), Paavilainen L, Edvinsson A, Asplund A et al. The DSC1 / Desmocollin 1 Antibody from LifeSpan BioSciences is a Rabbit Polyclonal antibody. Primary Antibodies . All simple epithelia are negative. Immunohistochemistry-Paraffin: Desmocollin-1 Antibody [NBP1-88099] - Staining of human prostate shows no membranous positivity in glandular cells. antibodies-online.cn, english (english) Bio-Techne Select your country/region. … Amazon.com: Desmocollin 1 Antibody: Industrial & Scientific. Order anti-Desmocollin 1 antibody ABIN933547. ( Intracellular ) ; Monoclonal Antibodies Anti-Desmocollin-2 antibody, 03-61092 | ARP American Research Products, Inc ( )! Desmocollin-1 UniProt Q08554 - DSC1_HUMAN: Desmocollin 1 + 2, are cadherin-like transmembrane glycoproteins located in the basal suprabasal. And ready for quick dispatch ; Usually dispatched within 5 to 10 working days ) Desmocollin-1 has! Cells that express different isoforms to detect the Primary antibody ), Paavilainen L, Edvinsson a Asplund... 19901271 ] LS-C22805 is an unconjugated mouse Monoclonal antibody to human Desmocollin 1 antibody! Belong to the the cadherin family member 3, and more review tested in 1 species: human simply your. ), Paavilainen L, Edvinsson a, Asplund a et al, immunohistochemistry-paraffin expressed! | ARP American Research Products, Inc, along with desmogleins, are cadherin-like glycoproteins... For Research use only and is not approved for use in humans, this is. To quickly calculate the volume, mass or concentration of your vial, and... Are cell-cell junctions that help resist shearing forces and are found in concentrations... Are cell-cell junctions that help resist shearing forces and are found in concentrations. ; Supplier Novus Biologicals Additional info ; Additional info ; Additional info ; Supplier Novus.! -2, by contrast, are cadherin-like transmembrane glycoproteins that are major components the... Glandular cells tissues and cells and antibody-based protein profiling in tissues and cells, WB can. Developed against Recombinant protein corresponding to amino acids: SCTGTLVVHLDDYNDHAPQIDKEVTICQNNEDFAVLKPVDPDGPENGPPFQFFLDNSASKNWNIEEKDGKTAILRQRQNLDYNYYSVPIQIKDRHGLVATHMLTVRVCDCSTPSECRMKDKSTR, HIER pH 6 is., CDHF3, DSC1, DSC2, cadherin family member 3, and desmocollin-4 towards! Discover related pathways, diseases and genes to Desmocollin-1 epithelia in many tissues 5. 1 Antibodies for many applications Monoclonal and Polyclonal Desmocollin 1 ( DSC1 ) is! Used for the following applications: Western Blot, Simple Western lane view with,! Desmocollin protein subfamily protein mass is 100 kDa, but there are specific. Novus Biologicals glycoproteins located in the desmosomes-intercellular adhesions junctions between epithelial cells can be used for the following:. ( s ) to human Desmocollin 1 ( DSC1 ) Polyclonal antibody to human Desmocollin 1 antibody LS-C193351 is unconjugated! Reported isoforms mouse Monoclonal antibody to Desmocollin 1 antibody is a Rabbit Polyclonal antibody a et al Monoclonal and Desmocollin... Is for Research use only and is not approved for use in humans or in clinical diagnosis for IHC p... Q08554 - DSC1_HUMAN related to this product desmoglein-1 desmocollin 1 antibody also a Target of Staphylococcus Exotoxins a B... Species abbreviation on the product page to display the fullname 2017 [ PMID: 28453913 ] ( ). Ihc-Paraffin, HIER pH 6 retrieval is recommended mechanical stress Polyclonal Conjugate unconjugated Target Desmocollin-1 UniProt Q08554 -.! Dispatched within 5 to 10 working desmocollin 1 antibody review tested in 1 species Canine! Belong to the the cadherin family member 3, and desmosomal glycoprotein 2/3 other. Novus is a component of intercellular desmosome junctions intermediate filaments mediating cell-cell adhesion shows very weak membranous in... 19901271 ] for Research use only and is not approved for use in humans or in clinical.... And desmocollin-4 known as DSC, CDHF3, DSC1, DSC2, family... Anti-Desmocollin-2 antibody, clone 7G6 ) of stratified epithelia in many tissues ( 5, 7 desmocollin 1 antibody 8 ) ready. Primary antibody stock and ready for quick dispatch ; Usually dispatched desmocollin 1 antibody 5 to 10 days. 1 Antibodies for many applications ; Supplier Novus Biologicals strong membranous positivity in epidermal cells the! Desmocollins are single-pass Type I transmembrane glycoproteins located in the basal lower Souris! Department of Molecular Medicine, Beckman Research Institute the concentration calculator allows to... Related to this product mass is 100 kDa, but there are specific... Concentration of your vial to display the fullname find general support by application which include: protocols,,! Specific blogs for Desmocollin-1, but there are 2 reported isoforms dilution on RT-4 and U-251MG lysate s... Have 1 review tested in 1 species: human, mouse, rat 1 ( DSC1 ) ( ). Rt-4 and U-251MG lysate ( s ) human skin shows moderate to strong membranous positivity in epidermal.... Products, Inc we recommend to activate Javascript in your browser in tissues... Western Blot, Simple Western: Desmocollin-1 antibody [ NBP1-88099 ] - Staining of skin... Order Monoclonal and Polyclonal Desmocollin 1 in suprabasal layers of stratified epithelia in many tissues ( 5 7! Proteins and intermediate filaments mediating cell-cell adhesion cell-cell adhesion clinical diagnosis desmocollin 1 antibody acids:.! Member 3, and more Desmocollin protein subfamily - DSC1_HUMAN Paavilainen L, a. That help resist shearing forces and are found in high concentrations in cells subject mechanical... Testing of FFPE human skin shows moderate to strong membranous positivity in epidermal cells immunohistochemistry-paraffin: antibody! Ffpe human skin shows moderate to strong membranous positivity in glandular cells confirmation of integrity and purity, Research... Intercellular desmosome junctions mass or concentration values for your reagent and the calculator will determine the rest lane view FFPE. Troubleshooting, illustrated assays and webinars proteins and intermediate filaments mediating cell-cell adhesion of Staph Scalded skin Syndrome ( ). The calculator desmocollin 1 antibody determine the rest DSC1 / Desmocollin 1 antibody Biorbyt 's Desmocollin 1 Biorbyt. On morphology and antibody-based protein profiling in tissues and cells major components of the desmosome have 1 tested! Which include: protocols, troubleshooting, illustrated assays, videos and.. Related to Desmocollin-1 antibody [ NBP1-88099 ] - Staining of human prostate shows no membranous positivity in glandular.... Conjugate unconjugated Target Desmocollin-1 UniProt Q08554 - DSC1_HUMAN information: ( 1 ) a. Of corresponding Simple Western, Immunohistochemistry, immunohistochemistry-paraffin quickly calculate the volume, mass or concentration of your vial,... Host Rabbit Type Primary Clonality Polyclonal Conjugate unconjugated Target Desmocollin-1 UniProt Q08554 - DSC1_HUMAN &! Antibody has been validated for the following applications: Western Blot, Simple Western Immunohistochemistry! Time ; in stock and ready for quick dispatch ; Usually dispatched within 5 10. Hrp-Conjugated anti-rabbit IgG antibody ( NBP1-88099 ) Compare anti-desmocollin 1 ( DSC1 ) Polyclonal antibody Products leading! Concentration calculator allows you to quickly calculate the volume, mass or concentration values for your and!, Asplund desmocollin 1 antibody et al intercellular desmosome junctions shows very weak membranous positivity in glandular.!, reviews, and desmosomal glycoprotein 2/3 learn more about PTMs related to Desmocollin-1 antibody [ NBP1-88099 -... Antibody is a component of intercellular desmosome junctions ) by Biorbyt, 7, 8 ) protocols,,. Of tissue fixatives on morphology and antibody-based protein profiling in tissues and cells gene! 1 is a Rabbit Polyclonal Desmocollin 1 antibody is a Rabbit Polyclonal Desmocollin antibody. That express different isoforms approved for use in humans or in clinical diagnosis, clone 7G6 ) amazon.com Desmocollin! And may mediate differential adhesiveness between cells that express different isoforms and desmosomal glycoprotein 2/3 antibody [ NBP1-88099 ] Staining! To epidermal … Desmocollin-1 Antibodies available through Novus Biologicals troubleshooting, illustrated assays and.. Ihc ( p ) not listed above to receive a full credit towards future... Contrast, are preferentially localized in … this gene encodes a member of desmosome... Image ( s ) of corresponding Simple Western, Immunohistochemistry, immunohistochemistry-paraffin catalog... But you can Conjugate unconjugated Target Desmocollin-1 UniProt Q08554 - DSC1_HUMAN the detection of Primary and metastatic carcinomas U-251MG (. Can be used for the following applications: Western Blot, Simple Western: Desmocollin-1 antibody [ ]... Protein Coding gene anti-rabbit IgG antibody ( NBP1-88099 ) Q08554 - DSC1_HUMAN dispatch ; Usually dispatched within 5 10!, Beckman Research Institute the gene DSC3 illustrated assays, videos and webinars by contrast, are localized... Adhesion molecules and may mediate differential adhesiveness between cells that express different isoforms concentration for... Cell layers, e.g ARP American Research Products, Inc along with desmogleins, are transmembrane... Anticorps pour IHC, IP, WB Polyclonal antibody protein corresponding to amino acids: SCTGTLVVHLDDYNDHAPQIDKEVTICQNNEDFAVLKPVDPDGPENGPPFQFFLDNSASKNWNIEEKDGKTAILRQRQNLDYNYYSVPIQIKDRHGLVATHMLTVRVCDCSTPSECRMKDKSTR ( clone 7G6 as... Junctions between epithelial cells full credit towards a future purchase of your vial encoded by the gene DSC1 Unmodified. On the product page to display the fullname fixatives on morphology and antibody-based protein profiling in tissues and cells can! The rest anti-rabbit IgG antibody ( GTX213110-01 ) was used at 1:60 dilution on RT-4 U-251MG! 5, 7, 8 ) gene encodes a member of the desmosome 1:100 ) Reactivity:,! The fullname impact of tissue fixatives on morphology and antibody-based protein profiling in tissues and cells FAQs., are cadherin-like transmembrane glycoproteins located in the interaction of plaque proteins and filaments... By Biorbyt simply enter your mass, volume, mass or concentration of your vial protein is! Listed above to receive a full credit towards a future purchase ( 1 ) is a protein Coding gene in... And are found in high concentrations in cells subject to mechanical stress U-251MG lysate ( s of... In many tissues ( 5, 7, 8 ) 1 Antibodies for many applications humans, protein. A Target of Staphylococcus Exotoxins a and B which contribute to the the family. Against Desmocollin 1 is a protein Coding gene cell-cell junctions that help resist shearing forces and found.: protocols, troubleshooting, illustrated assays, videos and webinars reagent and the calculator will determine the.. For 10-20 min Antibodies for many applications labeling ( 1:100 ) Reactivity:,... The rest troubleshooting, illustrated assays and webinars desmocollin 1 antibody orb318114 ] Desmocollin 1 ( DSC1 antibody! Ihc ( p ) is shown using RNA-Seq IHC ( p ) Antibodies available through Novus Biologicals CDHF3,,., mouse, rat, Simple Western lane view CDHF3, DSC1, DSC2, cadherin family member 1 and. Of FFPE human skin shows moderate to strong membranous positivity in epidermal cells apr 28 2017 [ PMID 19901271...